Tag Archives: Vaginal sex

[Java] [CSdev] Cultivation Spiral [Release 1d]


Release Date: 2025-02-07
Developer: CSdev Patreon
Censored: No
Version: Release 1d
OS: Windows
Language: English

Overview:
Step into a world not too different from our own. Befriend a cast of characters from all walks of life, each with their own struggles and their own insights into the big puzzle of reality. Find romance together, and discover how wonderful the universe can be when you have somebody to share it with.

But before the flower of love can fully bloom, tragedy strikes. The small dramas of your everyday life are overshadowed by a malevolent plot, an unavoidable doom, and a mysterious phenomenon. Your carefree days cannot last forever.

In order to take back what was lost, you will need to change. Develop your skills, use all the tools at your disposal, and learn what you can from your companions. Seek mastery over yourself, over society, and over the so-called laws of reality. With perseverance, there is no limit to what you can accomplish. You will be something more than human.

Cultivation Spiral is an incremental game with visual novel elements. Every day, you choose who you spend time with and what you do together. Depending on your choices, you gradually develop skills which allow you to do more and do it better. Eventually, this will lead to scenes where you deepen your relationships. The game has romance scenes for any combination of male and female protagonists and love interests (although as of this writing, not all combinations have art assets in the included image pack). The game’s visual assets are created with AI assistance. The game’s music and sound effects are from the Creative Commons, and the credits for their creators may be found in the game’s assets folder.

Because the player continually gets more and more powerful, all content can be seen by just playing the game casually. However, by using your time wisely, it’s possible to complete the game in a smaller number of in-game days. If you manage to figure out a particularly fast route, then feel free to send your save file to the developer, and you might be included in the next release’s leaderboard! The game will also inform you if you manage to beat the developer’s high score.

Release 1d
-Content: Added scene variants (and a new outfit) which display when completing Tanaka’s goals on Day 32 (or theoretically later).
-Content: Added scene variants for meeting Jackal at the country club before hiring her for the first time.
-Content: Added “Truthseeker” achievement (becomes visible after Savior achievement is obtained, recommended 1000 Meaning of Life before attempting).
-Content: Added “Impatience” upgrade which becomes available after Truthseeker is achieved for the first time.
-Interface: The further you have progressed through the story, the more quickly earlier story scenes will be skipped through.
-Interface: Added a toggle to make Auto mode skip through one day at a time.
-Interface: The game will no longer ‘helpfully’ start the day at a later time slot in order to show you something.
-Interface: Added separate buttons to directly navigate to each middle display. The hotkey still cycles between them as before.
-Interface: It is now possible to navigate directly to a time slot or routine option by clicking on the associated section of the day summary.
-Interface: Added the “Looply” default action selection option, unlocked by going to the Metropolis for the first time.
-Interface: Improved the game’s logic for deciding which action to select by default when the previously selected action becomes unavailable (e.g. Leave door unlocked -> Snooze together).
-Interface: Continuous Auto mode will no longer be deactivated by story scenes which have been seen before.
-Bugfix: Charisma and relationship tooltips will now properly account for popularity level.
-Bugfix: The game will no longer sometimes fail to update which upgrades are allowed when switching between save files.
-Other: Reduced unneeded loading of re-used background images to improve performance.
-Other: Copied the in-game tips from the New Day screen into an external file.

Release 1c
-Bugfix: Resolved a crash that could happen when going to the Metropolis
-Bugfix: The tooltip for Charisma will now correctly take the Magnetism upgrade into account.
-Other: A bunch of typo fixes.

Release 1b
-Initial public release

 

Win: MEGAFASTUPLOADDOWNLOADGGWORKUPLOADGOFILEPIXELDRAIN

Extras: Recent Release & Asset Hub

[Wolf RPG] [tada no deko] The Misty Ruins and The Lone Swordsman [v1.06]



Release Date: 2023-12-31
Developer: kaniheadcrab Ci-en
Translator: DazedAnon – DiscordSupport
Censored: Yes
Version: 1.06
OS: Windows
Language: English (GPT4o)
Store: DLsite

Overview:
The protagonist, who is the caretaker of the ruins, encounters a young girl. The knights accompanying him inform that the girl is a criminal and came to the ruins to be executed.

The protagonist witnesses the execution, but monsters start appearing from the ruins in response to the girl’s powers and attack them. The knights are wiped out, and the girl has her powers drained by the ruins. After hearing the girl’s story, the protagonist decides to help her restore her powers. Thus begins their battle, using the ruins’ management office as their base.

Required: Patch the game with the latest fixes/changes by running GameUpdate in the game folder or by manually patching it via GitGud.
You may need to use local emulator software even if you have japanese language patch

 

Win: MEGAMIXDROPPIXELDRAINUPLOADHAVENWORKUPLOAD

[Unity] [Garlic Field] Showdown! ANDROGYNOS [v1.01]



Release Date: 2024 0-12-27
Original Title: 雌雄を決せ!アンドロギュノス
Developer: Garlic Field DLSiteCi-en
Censored: Yes (Mosaics)
Version: 1.01
OS: Windows
Language: English, Japanese
Store: DLSite

Overview:
Join a party of confident futanari elves on an exciting adventure in a world full of alluring monstergirls! Explore vibrant landscapes, from forests to caves, where the time of day and terrain change the challenges you’ll face.
Battle over 150 unique monstergirls, from graceful harpies to mysterious slimes. Weaken your foes and engage in thrilling “penis contests” to win through an intimate “fuckdown” mechanic, all brought to life with stunning pixel art animations.
In town, meet other futanari elves, upgrade your gear, and unlock steamy scenes by fulfilling special conditions. Complete your Monster Encyclopedia, master your skills, and lead your team to victory in this bold and adventurous journey!​

 

Win: KRAKENFILESMEGAMIXDROPPIXELDRAINWORKUPLOAD

[Ren’Py] [Zanith] A House In The Rift [v0.7.16r4]





Release Date: 2025-01-11
Developer: Zanith PatreonDiscordTwitter
Censored: No
Version: 0.7.16r4
OS: Windows, Linux, Mac, Android
Language: English

Overview:
You were thrown into a dimensional rift and have no idea what to do. Nevertheless, other castaways from different realities join you one by one in order to form an everlasting bond of trust, friendship and physical intimacy.

Beautiful girls from various fantasy dimensions take care of you during the day, and then you go off exploring rift oddities through the night. And you can bake cakes with a succubus, wrestle with a giant voluptuous pirate captain, study magic with a young girl acolyte, and then do some extracurricular activities with them, too.
Fall in love with the girls, fall in bed with them, and fall into the different rifts every night!​

v0.7.16r4

  • Watch Cait’s attempts to turn her life around…
  • …and try on a Goth Cait look. It’s not a phase, Miss Azraesha!
  • Dream about Rowen surreptitiously appearing in front of you, performing an indecent gesture
  • Check out an experimental (re)implementation of Rae’s signature spank and other minor actions with other girls

 

Win/Linux: GOFILEMEGAMIXDROPPIXELDRAINUPLOADHAVEN
Mac: GOFILEMEGAMIXDROPUPLOADHAVEN

Android Launcher: – GOFILEKRAKENFILES
Android RPA: GOFILEMEGAUPLOADHAVENUPLOADNOW

[Unity] [Sda-lab] Succubus Reborn [v20250207a]



Release Date: 2025-02-07
Developer: Sda-lab Ci-EnFanboxFantia
Censored: Yes
Version: 20250207a
OS: Windows
Language: English

Overview:
This is a single-player card game with the theme of “squeezing”.​

First, a couple of bugfix versions dropped that we skipped.
-Fixed Legend dropping two marks when leaving the field, an error caused by idle succubi still unsealing I think.
-Endless Sex wasn’t taking squeezers Pursuit into account.
-Some color fixes for scenes. No further details.

v20250207a
New scene, Royal Footjob.

20241231p2
-Added a setting that allows you to trigger your own Temptation effects. …That’s so cheating. Bunnygirl and Idol don’t care who activates their temptation, they always benefit their Player!
-You can now equip Rings to enemy squeezers with the reequip ability. I don’t know why you would want to do that, but you can. Throw a Hypno ring onto an enemy Cheerleader to direct-fire you own nuke?
-Nurse’s 3 now lasts until the end of the next turn. That’s just silly.
-‘Added a little dialogue about the seduction ability’. Who knows what that means, but I’m sure I’ll need to find out.

 

Win x64: GOFILEMEGAMIXDROPPIXELDRAINUPLOADHAVEN

[HTML] [XFiction] Transylvania [v0.5.12]



Release Date: 2025-02-08
Developer: XFiction PatreonOfficial WebsiteTFG Page
Censored: No
Version: 0.5.12
OS: Windows, Linux, Mac, Android
Language: English

Overview:
You are Alex, a poor student that decides to take a summer job working as a receptionist at the Crooked Elm, a hotel in a faraway mountain village deep in the Transylvanian region. Quickly you realize that nothing and no one in the village is what it seems, and every passing hour has you more embroiled in the mysterious happenings…

Transylvania is a game that allows you get yourself into all sorts of trouble, leaving you the choices to overcome obstacles and try to return to normal, or give in to your desires and change into something more.

TRANSFORMATION – EROTIC-HORROR – BAD ENDS – MONSTERS

0.5.12

Design Update
-The sidebar has been redesigned with new pixel art icons, a new border, a new font, and adjustments to spacing and style;
– Story Action icons have been updated with the following new icons: CHOICE (and variants), TALK, RETURN, EXAMINE, WAIT, UNLOCK,
– Actions can now be animated, with animations triggering on hovering the respective choice. For now only the basic CHOICE action is animated, with the rest to follow;
– Story Chapters and location names have been updated with a new font;
– Bad Ends have been udaped with a new font, as well as a low opacity text letting the player know that there is a clickable image that can allow you to continue playing after a Bad End;
– Location titles have been updated with a new font;
Chapter 2
-Feeding the bruxas has been overhauled again;
-feeding the bruxas now has 3 new interactive illustrations per bruxa, for a total of 6;
-getting your wings from the Elder has been overhauled;
-getting your wings from the Elder has a new interactive illustration, with multiple possible branches;
-talking to the Elder about your wings no longer forces you to accept his help;
-added new scenes and options during this branch;
Blanace & improvements
-Reduced the max challenge penalty for the cursed heads;
-Sabrina’s portals will grant you slightly higher upsides and slightly lower downsides;
-entering the Crypt will temporarily pause hunger accumulation;
-the patreon “Travel” cheats have been updated to include more locations/characters/events across all 3 chapters for easier jumping around;

 

All: GDRIVEMEDIAFIREMEGAKRAKENFILESPIXELDRAIN

[Unity] [HamptaVerse] Tricky Traps & Naughty Acts [v0.1.1a]



Release Date: 2025-02-06
Developer: HamptaVerse Patreon Itch.ioDiscordTwitter
Censored: No
Version: 0.1.1a
OS: Windows
Language: English
Voiced: English

Overview:
Tricky Traps & Naughty Acts is a Free NSFW Point & Click game about destroying your grumpy neighbor. Your goal is to annihilate him using traps and have fun with the sexy residents of the house while filming everything that happens to stream it online…

Developer Notes:

After six months of hard work, we are thrilled to finally present the Alpha version of our game!

In this version you’ll see:
• Core game mechanics
• Several levels in the neighbor’s house
• Several 18+ animated scenes

We hope you’ll enjoy it!
If you want to stay updated and be among the first to play the upcoming versions of the game or help with its development, please support us by subscribing to our Patreon!
>>>
The game’s page on Itch.io <<<
>>>
Join our Discord server <<<
>>>
Follow us on Twitter(X) <<<
WARNING: The game may contain bugs. If you encounter any, please let us know on our Discord server. Thanks

 

v0.1.1a – 6 Feb 2025
What’s new:
– Added a new level and a new 18+ animated scene;
– Fixed some bugs and other issues;
– Removed the voice acting due to mixed reviews from players;

 

Win: MIXDROPWDHOWORKUPLOAD – – GOFILEKRAKENFILESMEGAPIXELDRAIN

[Ren’Py] [SaltyStupidFish] The Simpsons Dating Sim [v0.6.0]




Release Date: 2025-02-05
Developer: SaltyStupidFish PatreonItch.io
Censored: No
Version: 0.6.0
OS: Windows, Linux, Mac
Language: English

Overview:
Live in the Simpson’s home, finish high-school, and date Simpson’s characters.
You play as a college aged boy, who has to take an adult high-school class full of girls who didn’t finish high school on time.

You can buy Items for girls. Impress them with flirting. Focus on the women you choose. Get a Job. Stay Clean (Shower). Or you can just buy a bunch of deodorant if you don’t want to shower. There’s options, and things to do.​

v0.6.0

☆☆☆ What’s New! ☆☆☆
Story
Art
Game Play and Other Stuff
Bug Fixes

  • A collection of Stories for Kwik-E-Mart Job. These involve Manjula, Apu and different shoppers.
  • +1 Edna Story
  • +1 Marge and Lurleen Story
  • New Kwik-E-mart background
  • New Art and animations for the new stories
  • New Animated sequence for Lisa showering
  • Other Msc. Art Improvements, such as numerous character’s bodies and faces redrawn
  • Marge, Kearney, Jimbo, and Maude go the Kwik-E-Mart. (new drawings)
  • Interactions for smelling bad are always added for new characters.
  • You can no longer work the Kwi-E-mart job for Apu if you smell, but there’s a unique interaction if you keep trying.
  • New Locations in the Kwik-E-Mart
  • Some existing story polishing. No major changes. Dialogue tweaks.
  • New Sex scene available for Edna (For Lurleen/Marge too but theirs is only in the story)
  • Removed Lock Icon from power plant building

☆☆☆ What’s Ahead! ☆☆☆
My Focus has been to create more content, while improving art. My focus is now to create more content, while improving at animation specifically. So the next version will have more stories, more content, and hopefully even better animations.

 

Win/Linux: GOFILEKRAKENFILESPIXELDRAINWORKUPLOAD
Mac: GOFILEKRAKENFILESWORKUPLOAD

[Unity] [Crime] Lovely Craft Piston Trap [v0.2]



Release Date: 2025-02-06
Developer: Crime – Patreon
Censored: No
Version: 0.2
OS: Windows, Android
Language: English

Overview:
Minecraft piston sex machine simulator​

v0.2

  • Farmer girl and Alex in the boat as mobs for piston
  • Alex’s trading reactions & voice-over
  • The piston’s auto mode can be activated at any height, allowing you to do auto anal
  • Massive price deflation and progress speed up
  • Drag the mob by the breasts
  • Black dildo variation and optional balls
  • FX animation improvements
  • Bugfixes

 

Win: GDRIVEMEGAYOURFILESTOREGOFILEMIXDROP
Android: GDRIVEMEGAYOURFILESTOREGOFILEMIXDROP

[RPGM] [Unit009] Miss Nat’s Rural Town Adventure [v0.002a]



Release Date: 2025-02-02
Developer: Unit009 PixivFanboxX
Censored: No
Version: 0.002a
OS: Windows
Language: English

Overview:
Nat is a voluptuous MILF looking for excitement in a new city—discover what kind of adventures await her!​

 

Win: BUNKRGOFILEMIXDROPPIXELDRAINWORKUPLOAD