Tag Archives: Interracial

[RPGM] [SlingBang] Harlot’s Path [v1.20d]


Release Date: 2025-02-17
Developer: SlingBang NewgroundsPatreon
Censored: No
Version: 1.20d
OS: Windows
Language: English

Overview:
Harlot’s follows in her mother’s footsteps in this 3~4 hour RPG. containing 8 re-playable sex events that unlock more features as you progress.​

Patreon Passwords:

slingk

 

Win: GOFILEKRAKENFILESMEGAMIXDROPPIXELDRAIN
Others: ONLINE

Extras: WALKTHROUGH

[RPGM] [Headpat] The stereotype that only girls play healers isn’t true at all!!! [v1.61]



Release Date: 2025-02-13
Developer: Headpat SubscribeStaritch.ioWebsite
Censored: No
Version: 1.61
OS: Windows
Language: English

Overview:
You live together with your wolf-girlfriend Luna and you like to play videogames together, why not try an MMO?

While out adventuring with Luna, the game will have a more active battle system while still utilizing side-images of the girl like the previous game.
Luna will wander around and fight monsters and it’s your job to keep her healthy!
If you let her health drop too much her armor might start breaking, making things a lot worse.

However, it will not be so easy!
If that sounds like a terrible escort-NPC quest, which are way too common in MMO games, that’s because it is!

It turns out Luna has severe tunnel-vision while playing!
She charges in and pulls more mobs than necessary, she lets monsters hit her in the back and doesn’t pay attention to your mana at all!
Despite being the tank, don’t expect her to take monsters off from you.
As a healer who is not getting any help from the team, you must adjust to the situation and manage your mana carefully!

Developer Notes:

Rather than following only a linear story, the game will have many important characters offering various quests.
Completing their quests allows you to progress their story arcs, unlock new areas and earn special… rewards!The main focus will be NTR, monstersex and big floofy tails.
If you are familiar with our previous games you know what to expect.Similar to our previous game, Luna will wander around on her own and it might be a bad idea to leave her unattended for too long.
Men seem eager to recruit her to parties due to tanks being in very high demand.
I’m sure she loves you enough that she won’t drop you for a better equipped and higher leveled healer, right?However, this time there will be a little twist!
The game will be split between two worlds, real life and the MMO.In the game world you can go AFK and return back to the real world.
If you can’t find Luna anywhere it might be worth looking around the house. Maybe she is just in the kitchen getting a snack?

 

Characters:

Luna is an overconfident Wolfgirl you’ve known since you were little. Having a rather tomboyish attitude she expresses her love for you by being mean!
Being good at games, she wants to be a tank and picked the Warrior class.
To make a good team you decided to become a healing Priest!Jam the slime-girl merchant!
Despite being a monster, she somehow ended up in a player town and decided to open up shop.
She’s very unfamiliar with human customs such as how shops work. It can be very awkward dealing with her but she is trying her best to learn.
Thankfully other adventurers seem very eager to interact with her so she can learn a lot.Her shop and wares may look a bit shabby but please buy a lot and make her dream of a successful business come to fruition!!Pudding the foxgirl alchemist!
She might be interested in joining your party but she doesn’t have any combat skills at all. Why exactly does she want to join then!? Sounds like she wants to leech EXP from your adventures, if you ask me!
She also seems to get a little too familiar with Luna and is actually quite… grabby with her. But they’re both girls so you don’t have to worry about it.As a foxgirl she has a massive tail which attracts a lot of attention but she seems to have a difficult time talking to men. If she gets approached too often she runs off and disappears for a while. It’s probably best to give her some time.

 

v1.61
Luna’s public build is updated to 1.6.1, adding multiple H-scenes just in time for Valentines! Go spend it with your wolf girlfriend!!

 

Win: GOFILEKRAKENFILESMEGAMIXDROPPIXELDRAIN
Linux: GOFILEKRAKENFILESMEGAMIXDROPPIXELDRAIN

[VN] [Ren’Py] [AbyssGames] Shadows of Ambition [Ch.4]





Release Date: 2024-12-25
Developer: AbyssGames – Patreon
Censored: No.
Version: Chapter 4
OS: Windows, Linux, Mac
Language: English

Overview:
Welcome to Shadows of Ambition! It’s an adult Kinetic Novel that will explore the relationship between Luke and Alice. Join Luke in his journey to Nyctora City where he meets his girlfriend Alice and a whole cast of different characters. Luke will get entangled in a whole bunch of different hot scenarios which will test his resolve. Will he stay the pure hearted soul that he is, or will he surrender himself to corruption? This game will try to cater to different sexual experiences including NTS/NTR. As this is a Kinetic Novel, no player choices will be available to alter the story.​

Chapter 4
480+ new renders
New Music & SFX
8500 lines of code
65000 words
Bug fixes

 

Win/Linux: GOFILEKRAKENFILESMEGAMIXDROPPIXELDRAIN
Mac: GOFILEKRAKENFILESMEGAMIXDROPPIXELDRAIN
Android: GOFILEMEGAMIXDROPUPLOADHAVENWORKUPLOAD

[HTML] [Aphrodite] X-Change™ Life [v0.21.5]





Release Date: 2025-02-14
Developer: Aphrodite – SubscribeStarTFgamesWiki
Censored: No
Version: 0.21.5
OS: Windows
Language: English

Overview:
X-Change Life is a daily life Twine RPG based in a universe where it’s normal to take over-the-counter,
gender swapping pills that last 24 hours (or more).​

v0.21.5

  • New story chapter, with integrations into the office gameplay loop. I don’t want to spoil it too much, so I’ll just let you know how to get it… to trigger the sequence of events and big sex scene, you need to:
  • Piss Bruce off somehow, by either pilling him with a Bimbo/Cum-Cure/Breeder pill, or getting into a deal with him for sex and breaking it off early.
  • Get promoted to sales level 3 at the office. After that, once you go into work and leave work the next time, the scene will trigger.
  • The ability to now perform Female to Female transformations in the New-U machine, allowing you to transform to a different female body even if you’re already female. To unlock this functionality, you will need to play the story chapter above. Watch out, because doing these f2f transformations can cause additional side effects…
  • Big new gym sex scene! This is for the Liya Silver character – check out the Wiki for info on how to unlock this scene. Warning that there’s fairly high pregnancy risk in this one, so I recommend getting those anti-sperm nanobots. Gym scenes are the most mechanically complex and fun scenes in the game, so make sure to check out all of the available ones (each one has enough sex writing to be equivalent to a mini novel due to all the different things that can happen)! https://x-change.life/wiki/docs/outfits-that-unlock-unique-gym-scenes/
  • New secretary for YOU to fuck, instead of just getting fucked AS a secretary! Her name is Hailey – you can access her office from the break room. I’m still in the process of adding features to her, but now, you can:
  • Train her like a Tamagotchi to help you with work! She can do a lot of the same things you can as a secretary, help you upgrade leads, prevent demos, etc.
  • Get coffee
  • Fuck her
  • Flirt / tease / have lots of little interactions that will build your relationship
  • But note, you have to have a DESK LEVEL of at least 4 to get her to help you. You can earn desk levels faster by DOING secretary work yourself, or just by doing lots of sales the old fashioned way and asking Ray downstairs to upgrade your desk!
  • When the story chapter is happening, your workplace will react, and all your colleagues will treat you differently, because the options for what products you can sell at work will be restricted.
  • 100+ New ASMR “taunts” in the masculinity minigame, which are more immersive and react the actual choices and scores you achieve in the game
  • The ability to upsell at work in the sales game, which allows you to sacrifice chance of sale in order to boost the overall order amount. A risk/reward type thing.
  • Sometimes when your sexual reputation at work is really high, colleagues will just come into your office and take what they want! (Only if non-con is turned on)
  • A sauna where you can pay $25 a week to increase your fitness XP earned
  • Lots of other bugfixes and quality of life improvements!

 

All: MEGAGOFILEMIXDROPPIXELDRAIN

[Unity] [Selectacorp] Company Man [v2.1.1]



Release Date: 2024-10-09
Developer: Selectacorp PatreonWebsite
Censored: No
Version: 2.1.1
OS: Windows, Mac
Language: English

Overview:
Company man is a reboot of Corporate Raider. It basically poses this question- if YOU had the power to make the rules in a company that you controlled, what would you do— and to whom would you do it?

Important:
Old saves may not work with the current version. A New Game may be required.​

 

v2.0.1
Minor tweaks made based on fan feedback. Nothing too major so ok to continue to play your current game, unless impacted by the edits as described below:
1.) Titan Defence Contract Mission was improperly giving 6 Power Points. Now only gives 3 Power Points.
2.) Golden Palace Restaurant previously unlocked by a Britney event. Now unlocks after completion of first Consulting project event. This was game breaking in later game if you didn’t complete the Britney event.
3.) Deborah After Work NPC was unlocked by meeting Deborah at Airport. Now unlocks after completion of first Consulting project event. This was game breaking in later game if you didn’t complete the Deborah at Airport event.

v2.0.0
1.) The Bowen Event chain from v1.9 has been tested and now seems to work as intended.
2.) Disclaimer screen added.
3.) Loopholes for pawn shop events fixed
4.) Marta Refugee/London loophole now fixed
5.) Additional image sets for Katie Jones and Deirdre Kelly
6.) New colored hair image sets for Debbie Jones (Punk and Goth)
7.) New option now available for the Hamiltons
8.) New event chain added for Deirdre Kelly
9.) New car events added
10.) New events added for Hollister Academy
11.) New Debbie location added
12.) New look and events added for Pomeroy’s Cinema and Golden Palace
13.) New Data Analysis Group location added
14.) New Britney Bower location added
15.) Two new airport destinations added
16.) Four new game achievements added
17.) Low Anna Sarin and Susan Granger audio has been fixed
18.) Additional audio for Deborah, Debbie, Tracey characters
19.) Legal Dept. can now generate spreadsheets
20.) Improved deep fake vids
21.) Soundtrack audio tracks in multiple locations
22.) General game balancing of various events
23.) Hundreds of typos and continuity issues addressed

 

Win: GOFILEMIXDROPUPLOADHAVEN
Mac: GOFILEMEGAMIXDROPPIXELDRAINUPLOADHAVEN

[Unity] [The Dancing Inn] The Dancing Inn [v0.2.2]






Release Date: 2025-02-11
Developer: The Dancing Inn PatreonXDiscord
Censored: No
Version: 0.2.2
OS: Windows
Language: English

Overview:
A sim-brothel type of adult game you never knew you wanted!​

v0.2.2
Content
Added unique sprites for request system
Added unique foot request (and sprites for all girls)
Added animation for girl cards on hover
Added Saultry Saute perk sprite
Added Flirt Fry perk sprite
Added Gastrorgasm perk sprite
Added Loving Bite perk sprite
Added Saultry Saute perk
Added Loving Bite perk
Added Flirt Fry perk
Added Gastrorgasm perk
Added Lurcel character
Added Gina the tax girl
Added Gina’s office location
Added Gina office event (32 sprites)
Added Gina’s goblin event (39 sprites)
Added 10 new rock sprites
Added 9 new dirt pile sprites
Added new difficulty selection UI in main menu
Introduced casual difficulty – no taxes
Added tooltips for difficulty modes
Strength now affects chopping power in woodcutting minigame
Added Tireless player endurance perk
Added Smooth Operator player charisma perk
Addded Issa new fortune on solving the parchment
Added Gina in the Thane’s Road interactive object
Added support for objects that appear only on certain days
Added support for animation clips in dialogue
Added Gina in the office dialogue
Added Gina fortunetelling tip
Added xp gain for unlocking new girls
Added new treasures in the world
Added on hover animation for request areas for girls that fulfill the requests
Added woodchopping tutorial
Added depravity override for watching older sprites
Added tax break option for Gina
Added multiple treasure bags to the world
Inpainted and added 32 Alma serving sprites
Inpainted and added 24 Issa cleaning sprites
Balance
Peach Perfect buff 20%->35% chance to get bonus 10->20 toad tip when serving or dancing
Twinkle toes buff 5% chance to get 100->300 gold
Reduced taxes from buying kitchen (50->20)
Bugfixes
Erase save now exits to menu to avoid data corruption

 

Win: GOFILEMIXDROPUPLOADHAVENMEGAPIXELDRAIN

[Ren’Py] [CHAIXAS-GAMES] BBW Plaything [v1.0]




Release Date: 2024-12-25
Developer: CHAIXAS-GAMES PatreonWebsiteTwitter
Censored: No
Version: 1.0
OS: Win, Linux, Mac, iOS, Android
Language: English

Overview:
You’ll soon be having fun with your virtual slut!​

 

Win: KRAKENFILESMEGAMIXDROPPIXELDRAINUPLOADHAVEN
Linux: KRAKENFILESMEGAMIXDROPPIXELDRAINUPLOADHAVEN
Mac: KRAKENFILESMEGAMIXDROPPIXELDRAINUPLOADHAVEN
iOS: KRAKENFILESMEGAMIXDROPPIXELDRAINUPLOADHAVEN
Android: KRAKENFILESMEGAMIXDROPPIXELDRAINUPLOADHAVEN

[RPGM] [haneshippo] The Scarlet Devil Mansion and the Book of Succubi [v1.01]



Release Date: 2023-05-19
Developer: haneshippo Ci-en
Translator: Null Partition
Censored: Yes
Version: v1.01
OS: Windows
Language: English
Store: DLsite

Overview:
Flan, Patchouli, and Sakuya end up trapped in the “Book of Succubi” by chance.
Can they escape the naughty enemies in their path?​

Changelog:

ver1.01 Fixed the behavior when pressing the cancel button while selecting a book to put on the shelf in the Great Library
ver1.00 Product version released

 

Developer Notes:

A short RPG with a party of three people and erotic combat

<What kind of game is it?>
Enemies restrain you during battle!
→ If you don’t release the restraints, you’ll be raped!
→ If you’re raped, you’ll climax and be unable to fight!!
There are also erotic abnormalities!

Estimated play time: about 1.5~2 hours
30 types of basic erotic standing pictures (10 types x 3 people)
There are also standing pictures of attacks, damage taken, and being unable to fight, in addition to the above.

Elements included in the game
– Restraint → Rape and abnormal status changes during battle and erotic events
– Interspecies sex (some yuri sex)
– Fully clothed
– Main character dots and enemy illustrations are original
– Standing pictures after completion, battle gallery and cheat weapons for those who don’t want to bother completing the game

Elements not included in the game
– No erotic scenes other than the main three
– No undressing elements such as damage undressing
– No erotic scenes with a single image when defeated, etc.
(There is one bonus image on the game over screen)

 

Win: GOFILEMEGAMIXDROPPIXELDRAINGDRIVE

[HTML] [XFiction] Transylvania [v0.5.12]



Release Date: 2025-02-08
Developer: XFiction PatreonOfficial WebsiteTFG Page
Censored: No
Version: 0.5.12
OS: Windows, Linux, Mac, Android
Language: English

Overview:
You are Alex, a poor student that decides to take a summer job working as a receptionist at the Crooked Elm, a hotel in a faraway mountain village deep in the Transylvanian region. Quickly you realize that nothing and no one in the village is what it seems, and every passing hour has you more embroiled in the mysterious happenings…

Transylvania is a game that allows you get yourself into all sorts of trouble, leaving you the choices to overcome obstacles and try to return to normal, or give in to your desires and change into something more.

TRANSFORMATION – EROTIC-HORROR – BAD ENDS – MONSTERS

0.5.12

Design Update
-The sidebar has been redesigned with new pixel art icons, a new border, a new font, and adjustments to spacing and style;
– Story Action icons have been updated with the following new icons: CHOICE (and variants), TALK, RETURN, EXAMINE, WAIT, UNLOCK,
– Actions can now be animated, with animations triggering on hovering the respective choice. For now only the basic CHOICE action is animated, with the rest to follow;
– Story Chapters and location names have been updated with a new font;
– Bad Ends have been udaped with a new font, as well as a low opacity text letting the player know that there is a clickable image that can allow you to continue playing after a Bad End;
– Location titles have been updated with a new font;
Chapter 2
-Feeding the bruxas has been overhauled again;
-feeding the bruxas now has 3 new interactive illustrations per bruxa, for a total of 6;
-getting your wings from the Elder has been overhauled;
-getting your wings from the Elder has a new interactive illustration, with multiple possible branches;
-talking to the Elder about your wings no longer forces you to accept his help;
-added new scenes and options during this branch;
Blanace & improvements
-Reduced the max challenge penalty for the cursed heads;
-Sabrina’s portals will grant you slightly higher upsides and slightly lower downsides;
-entering the Crypt will temporarily pause hunger accumulation;
-the patreon “Travel” cheats have been updated to include more locations/characters/events across all 3 chapters for easier jumping around;

 

All: GDRIVEMEDIAFIREMEGAKRAKENFILESPIXELDRAIN

[Ren’Py] [BearGames] Summer Temptations [v0.4p1 ]




Release Date: 2024-11-27
Developer: BearGames PatreonItch.io
Censored: No
Version: 0.4p1
OS: Windows, Linux
Language: English

Overview:
You and your adventurous girlfriend Aria stumble into some dark secrets… You know little of what was going on around you your whole life until this very moment…
As the story unfolds, you find yourself torn between humility and unexplored desires, while Aria, your playful and adventurous girlfriend, gently encourages you to open up to new experiences.​

 

Win/Linux: GOFILEMEGAMIXDROPPIXELDRAINUPLOADHAVEN